General Information

  • ID:  hor007257
  • Uniprot ID:  Q9DG81??19-132)
  • Protein name:  Gonadotropin subunit beta-1
  • Gene name:  NA
  • Organism:  Ictalurus punctatus
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Characiphysae; Siluriformes (catfishes); Siluroidei; Ictaluridae (bullhead catfishes); Ictalurus; Ictalurus punctatus (Channel catfish) (Silurus punctatus)
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0016913 follicle-stimulating hormone activity; GO:0031762 follicle-stimulating hormone receptor binding
  • GO CC:  GO:0010628 positive regulation of gene expression; GO:2000866 positive regulation of estradiol secretion; GO:2000836 positive regulation of androgen secretion

Sequence Information

  • Sequence:  SECKARCCLTNISITVESDECGSCITVNTTACTGLCRTQERAYRSPVAPYFQNTCNFRDWTYETIQLPGCPLGVDSSFTYPVALSCECSQCNTEITDCGAFSMQPSSCHTHAYY
  • Length:  114
  • Propeptide:  MMRGVTMVLLLPMLVWAGSECKARCCLTNISITVESDECGSCITVNTTACTGLCRTQERAYRSPVAPYFQNTCNFRDWTYETIQLPGCPLGVDSSFTYPVALSCECSQCNTEITDCGAFSMQPSSCHTHAYY
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA